PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C025737P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 268aa    MW: 29383.4 Da    PI: 8.3971
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C025737P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1275.6e-403999262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +e+al+cprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknkk+ 
  MELO3C025737P1 39 PEQALRCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKKRP 99
                    7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-273792IPR003851Zinc finger, Dof-type
PfamPF027017.9E-344197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5064397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MDHSSGQHQE TQAQPLENML AISCPKVQQE NRKPMRPQPE QALRCPRCDS TNTKFCYYNN  60
YSLSQPRYFC KSCRRYWTKG GTLRNVPVGG GCRKNKKRPS PSTSSSSSPS SKRSHDQAAN  120
SGRLMLTDTH LPSLAFESTD LSLAFAKLQH QSNGQMGLFD TTHNSFQNLY SGFGTGSSGE  180
VENGGFPHFE HYNSSGVAST ATATAMKQEM VCSGDQNNMV LLGFPWQFNN NGDGNYMGDL  240
DAGRESWNFN GNGIGSSWHG LLNSPLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819220.0LN681922.1 Cucumis melo genomic scaffold, anchoredscaffold00082.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008463897.10.0PREDICTED: LOW QUALITY PROTEIN: dof zinc finger protein DOF5.3-like
TrEMBLA0A0A0KHN10.0A0A0A0KHN1_CUCSA; Uncharacterized protein
STRINGGLYMA12G07710.12e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50263051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.15e-43TARGET OF MONOPTEROS 6